Recombinant Human DECR2 Protein, GST-tagged
Cat.No. : | DECR2-2511H |
Product Overview : | Human DECR2 full-length ORF ( NP_065715.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DECR2 (2,4-Dienoyl-CoA Reductase 2) is a Protein Coding gene. Among its related pathways are Peroxisome and Metabolism. GO annotations related to this gene include receptor binding and 2,4-dienoyl-CoA reductase (NADPH) activity. An important paralog of this gene is PECR. |
Molecular Mass : | 57.2 kDa |
AA Sequence : | MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ] |
Official Symbol | DECR2 |
Synonyms | DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1; |
Gene ID | 26063 |
mRNA Refseq | NM_020664 |
Protein Refseq | NP_065715 |
MIM | 615839 |
UniProt ID | Q9NUI1 |
◆ Recombinant Proteins | ||
DECR2-2511H | Recombinant Human DECR2 Protein, GST-tagged | +Inquiry |
DECR2-1224R | Recombinant Rhesus monkey DECR2 Protein, His-tagged | +Inquiry |
DECR2-2414HF | Recombinant Full Length Human DECR2 Protein, GST-tagged | +Inquiry |
DECR2-27085TH | Recombinant Human DECR2, His-tagged | +Inquiry |
DECR2-1484R | Recombinant Rat DECR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DECR2-462HCL | Recombinant Human DECR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DECR2 Products
Required fields are marked with *
My Review for All DECR2 Products
Required fields are marked with *
0
Inquiry Basket