Recombinant Human DEFB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DEFB1-6715H |
| Product Overview : | DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. |
| Molecular Mass : | 7.4 kDa |
| AA Sequence : | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DEFB1 defensin beta 1 [ Homo sapiens (human) ] |
| Official Symbol | DEFB1 |
| Synonyms | DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1; |
| Gene ID | 1672 |
| mRNA Refseq | NM_005218 |
| Protein Refseq | NP_005209 |
| MIM | 602056 |
| UniProt ID | P60022 |
| ◆ Recombinant Proteins | ||
| DEFB1-2300M | Recombinant Mouse DEFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEFB1-2521H | Recombinant Human DEFB1 Protein, GST-tagged | +Inquiry |
| DEFB1-11929H | Recombinant Human DEFB1, GST-tagged | +Inquiry |
| DEFB1-6715H | Recombinant Human DEFB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DEFB1-17H | Active Recombinant Human DEFB1 protein(1-47aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB1 Products
Required fields are marked with *
My Review for All DEFB1 Products
Required fields are marked with *
