Recombinant Human DEFB124 Protein (23-71 aa), His-tagged
| Cat.No. : | DEFB124-1697H |
| Product Overview : | Recombinant Human DEFB124 Protein (23-71 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 23-71 aa |
| Description : | Has antibacterial activity. Curated |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 7.7 kDa |
| AA Sequence : | EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | DEFB124 defensin beta 124 [ Homo sapiens (human) ] |
| Official Symbol | DEFB124 |
| Synonyms | DEFB-24; |
| Gene ID | 245937 |
| mRNA Refseq | NM_001037500 |
| Protein Refseq | NP_001032589 |
| UniProt ID | Q8NES8 |
| ◆ Recombinant Proteins | ||
| DEFB124-1061R | Recombinant Rhesus Macaque DEFB124 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEFB124-1697H | Recombinant Human DEFB124 Protein (23-71 aa), His-tagged | +Inquiry |
| DEFB124-1236R | Recombinant Rhesus monkey DEFB124 Protein, His-tagged | +Inquiry |
| DEFB124-4857H | Recombinant Human DEFB124 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DEFB124-453H | Recombinant Human DEFB124 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB124 Products
Required fields are marked with *
My Review for All DEFB124 Products
Required fields are marked with *
