Recombinant Human DEFB124 Protein (23-71 aa), His-tagged
Cat.No. : | DEFB124-1697H |
Product Overview : | Recombinant Human DEFB124 Protein (23-71 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
Description : | Has antibacterial activity. Curated |
Source : | Yeast |
Species : | Human |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 7.7 kDa |
Protein length : | 23-71 aa |
AA Sequence : | EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name : | DEFB124 defensin beta 124 [ Homo sapiens (human) ] |
Official Symbol : | DEFB124 |
Synonyms : | DEFB-24; |
Gene ID : | 245937 |
mRNA Refseq : | NM_001037500 |
Protein Refseq : | NP_001032589 |
UniProt ID : | Q8NES8 |
Products Types
◆ Recombinant Protein | ||
DEFB124-1061R | Recombinant Rhesus Macaque DEFB124 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB124-453H | Recombinant Human DEFB124 Protein, MYC/DDK-tagged | +Inquiry |
DEFB124-1078H | Recombinant Human DEFB124 Protein (23-71 aa), His-SUMO-tagged | +Inquiry |
DEFB124-1236R | Recombinant Rhesus monkey DEFB124 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket