Recombinant Human DENND4A Protein, GST-tagged
Cat.No. : | DENND4A-5794H |
Product Overview : | Human MYCPBP partial ORF ( NP_005839, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a DENN domain-containing protein that may function as a guanine nucleotide exchange factor that specifically activates ras-related protein Rab-10. This protein also contains a interferon stimulated response element-binding domain and may be involved in regulating the v-myc avian myelocytomatosis viral (MYC) oncogene. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DENND4A DENN/MADD domain containing 4A [ Homo sapiens ] |
Official Symbol | DENND4A |
Synonyms | DENND4A; DENN/MADD domain containing 4A; c myc promoter binding protein , MYCPBP; C-myc promoter-binding protein; IRLB; c-myc promoter binding protein; DENN domain-containing protein 4A; MYCPBP; FLJ33949; KIAA0476; |
Gene ID | 10260 |
mRNA Refseq | NM_001144823 |
Protein Refseq | NP_001138295 |
MIM | 600382 |
UniProt ID | Q7Z401 |
◆ Recombinant Proteins | ||
DENND4A-5181Z | Recombinant Zebrafish DENND4A | +Inquiry |
DENND4A-301174H | Recombinant Human DENND4A protein, GST-tagged | +Inquiry |
DENND4A-5794H | Recombinant Human DENND4A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENND4A Products
Required fields are marked with *
My Review for All DENND4A Products
Required fields are marked with *