Recombinant Human DENR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DENR-3927H |
Product Overview : | DENR MS Standard C13 and N15-labeled recombinant protein (NP_003668) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DENR density-regulated protein [ Homo sapiens (human) ] |
Official Symbol | DENR |
Synonyms | DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3; |
Gene ID | 8562 |
mRNA Refseq | NM_003677 |
Protein Refseq | NP_003668 |
MIM | 604550 |
UniProt ID | O43583 |
◆ Recombinant Proteins | ||
DENR-3927H | Recombinant Human DENR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DENR-3544C | Recombinant Chicken DENR | +Inquiry |
DENR-4516M | Recombinant Mouse DENR Protein | +Inquiry |
DENR-800Z | Recombinant Zebrafish DENR | +Inquiry |
DENR-2466HF | Recombinant Full Length Human DENR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DENR-6975HCL | Recombinant Human DENR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENR Products
Required fields are marked with *
My Review for All DENR Products
Required fields are marked with *