Recombinant Human DENR Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DENR-3927H
Product Overview : DENR MS Standard C13 and N15-labeled recombinant protein (NP_003668) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.
Molecular Mass : 22.1 kDa
AA Sequence : MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DENR density-regulated protein [ Homo sapiens (human) ]
Official Symbol DENR
Synonyms DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3;
Gene ID 8562
mRNA Refseq NM_003677
Protein Refseq NP_003668
MIM 604550
UniProt ID O43583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DENR Products

Required fields are marked with *

My Review for All DENR Products

Required fields are marked with *

0
cart-icon
0
compare icon