Recombinant Human DEPDC7 Protein, GST-tagged
Cat.No. : | DEPDC7-4744H |
Product Overview : | Human LOC91614 full-length ORF ( AAH30970.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEPDC7 (DEP Domain Containing 7) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by Rho GTPases. An important paralog of this gene is DEPDC1B. |
Molecular Mass : | 84.7 kDa |
AA Sequence : | MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEPDC7 DEP domain containing 7 [ Homo sapiens ] |
Official Symbol | DEPDC7 |
Synonyms | DEPDC7; DEP domain containing 7; DEP domain-containing protein 7; novel 58.3 KDA protein; dJ85M6.4 (novel 58.3 KDA protein); TR2; dJ85M6.4; |
Gene ID | 91614 |
mRNA Refseq | NM_001077242 |
Protein Refseq | NP_001070710 |
MIM | 612294 |
UniProt ID | Q96QD5 |
◆ Recombinant Proteins | ||
DEPDC7-1504R | Recombinant Rat DEPDC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEPDC7-4744H | Recombinant Human DEPDC7 Protein, GST-tagged | +Inquiry |
DEPDC7-2334M | Recombinant Mouse DEPDC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEPDC7-4280C | Recombinant Chicken DEPDC7 | +Inquiry |
DEPDC7-4268Z | Recombinant Zebrafish DEPDC7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEPDC7-6972HCL | Recombinant Human DEPDC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEPDC7 Products
Required fields are marked with *
My Review for All DEPDC7 Products
Required fields are marked with *
0
Inquiry Basket