Recombinant Human DEPDC7 Protein, GST-tagged

Cat.No. : DEPDC7-4744H
Product Overview : Human LOC91614 full-length ORF ( AAH30970.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEPDC7 (DEP Domain Containing 7) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by Rho GTPases. An important paralog of this gene is DEPDC1B.
Molecular Mass : 84.7 kDa
AA Sequence : MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEPDC7 DEP domain containing 7 [ Homo sapiens ]
Official Symbol DEPDC7
Synonyms DEPDC7; DEP domain containing 7; DEP domain-containing protein 7; novel 58.3 KDA protein; dJ85M6.4 (novel 58.3 KDA protein); TR2; dJ85M6.4;
Gene ID 91614
mRNA Refseq NM_001077242
Protein Refseq NP_001070710
MIM 612294
UniProt ID Q96QD5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEPDC7 Products

Required fields are marked with *

My Review for All DEPDC7 Products

Required fields are marked with *

0
cart-icon
0
compare icon