Recombinant Human DEPDC7 protein, His-tagged
| Cat.No. : | DEPDC7-2514H |
| Product Overview : | Recombinant Human DEPDC7 protein(344-511 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 344-511 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QLLLKLLDFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNIEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DEPDC7 DEP domain containing 7 [ Homo sapiens ] |
| Official Symbol | DEPDC7 |
| Synonyms | DEPDC7; DEP domain containing 7; DEP domain-containing protein 7; novel 58.3 KDA protein; dJ85M6.4 (novel 58.3 KDA protein); TR2; dJ85M6.4; |
| Gene ID | 91614 |
| mRNA Refseq | NM_001077242 |
| Protein Refseq | NP_001070710 |
| MIM | 612294 |
| UniProt ID | Q96QD5 |
| ◆ Recombinant Proteins | ||
| DEPDC7-2334M | Recombinant Mouse DEPDC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEPDC7-2514H | Recombinant Human DEPDC7 protein, His-tagged | +Inquiry |
| DEPDC7-3071H | Recombinant Human DEPDC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DEPDC7-4280C | Recombinant Chicken DEPDC7 | +Inquiry |
| DEPDC7-5941HF | Recombinant Full Length Human DEPDC7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEPDC7-6972HCL | Recombinant Human DEPDC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEPDC7 Products
Required fields are marked with *
My Review for All DEPDC7 Products
Required fields are marked with *
