Recombinant Human DFFA protein, GST-tagged

Cat.No. : DFFA-2817H
Product Overview : Recombinant Human DFFA protein(O00273)(1-331aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-331aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 63.6 kDa
AA Sequence : MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DFFA DNA fragmentation factor, 45kDa, alpha polypeptide [ Homo sapiens ]
Official Symbol DFFA
Synonyms DFFA; DNA fragmentation factor, 45kDa, alpha polypeptide; DNA fragmentation factor, 45 kD, alpha polypeptide; DNA fragmentation factor subunit alpha; DFF 45; DFF1; DFF45; DNA fragmentation factor; 45 kD; alpha subunit; ICAD; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit; DFF-45;
Gene ID 1676
mRNA Refseq NM_004401
Protein Refseq NP_004392
MIM 601882
UniProt ID O00273

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DFFA Products

Required fields are marked with *

My Review for All DFFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon