Recombinant Human DFFA protein, GST-tagged
Cat.No. : | DFFA-2817H |
Product Overview : | Recombinant Human DFFA protein(O00273)(1-331aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-331aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.6 kDa |
AA Sequence : | MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DFFA DNA fragmentation factor, 45kDa, alpha polypeptide [ Homo sapiens ] |
Official Symbol | DFFA |
Synonyms | DFFA; DNA fragmentation factor, 45kDa, alpha polypeptide; DNA fragmentation factor, 45 kD, alpha polypeptide; DNA fragmentation factor subunit alpha; DFF 45; DFF1; DFF45; DNA fragmentation factor; 45 kD; alpha subunit; ICAD; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit; DFF-45; |
Gene ID | 1676 |
mRNA Refseq | NM_004401 |
Protein Refseq | NP_004392 |
MIM | 601882 |
UniProt ID | O00273 |
◆ Recombinant Proteins | ||
DFFA-2555H | Recombinant Human DFFA Protein, GST-tagged | +Inquiry |
DFFA-30138H | Recombinant Human DFFA protein, GST-tagged | +Inquiry |
Dffa-2532M | Recombinant Mouse Dffa Protein, Myc/DDK-tagged | +Inquiry |
DFFA-2817H | Recombinant Human DFFA protein, GST-tagged | +Inquiry |
DFFA-28396TH | Recombinant Human DFFA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DFFA-6967HCL | Recombinant Human DFFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DFFA Products
Required fields are marked with *
My Review for All DFFA Products
Required fields are marked with *
0
Inquiry Basket