Recombinant Human DFFB Protein(1-341aa), GST-tagged
| Cat.No. : | QKI-2091H |
| Product Overview : | Recombinant Human DFFB Protein(1-341aa)(Q96PU8), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-341aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 64.7kDa |
| AA Sequence : | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | QKI QKI, KH domain containing, RNA binding [ Homo sapiens ] |
| Official Symbol | QKI |
| Synonyms | QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923 |
| Gene ID | 9444 |
| mRNA Refseq | NM_006775 |
| Protein Refseq | NP_006766 |
| MIM | 609590 |
| UniProt ID | Q96PU8 |
| ◆ Cell & Tissue Lysates | ||
| QKI-2640HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
| QKI-2638HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
| QKI-2639HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QKI Products
Required fields are marked with *
My Review for All QKI Products
Required fields are marked with *
