| Species : | Human | 
                                
                                    | Source : | HEK293 | 
                                
                                    | Tag : | DDK&Myc | 
                                
                                    | Description : | The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. | 
                                
                                    | Molecular Mass : | 35 kDa | 
                                
                                    | AA Sequence : | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
                                
                                    | Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
                                
                                    | Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Concentration : | 50 μg/mL as determined by BCA | 
                                
                                    | Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |