Recombinant Human QKI Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | QKI-4501H |
| Product Overview : | QKI MS Standard C13 and N15-labeled recombinant protein (NP_996735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 35 kDa |
| AA Sequence : | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | QKI QKI, KH domain containing RNA binding [ Homo sapiens (human) ] |
| Official Symbol | QKI |
| Synonyms | QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923; |
| Gene ID | 9444 |
| mRNA Refseq | NM_206853 |
| Protein Refseq | NP_996735 |
| MIM | 609590 |
| UniProt ID | Q96PU8 |
| ◆ Recombinant Proteins | ||
| QKI-4501H | Recombinant Human QKI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| QKI-2091H | Recombinant Human DFFB Protein(1-341aa), GST-tagged | +Inquiry |
| QKI-11H | Recombinant Human DFFB Protein(11-290aa), His-tagged | +Inquiry |
| QKI-7322M | Recombinant Mouse QKI Protein, His (Fc)-Avi-tagged | +Inquiry |
| QKI-5883C | Recombinant Chicken QKI | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| QKI-2640HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
| QKI-2639HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
| QKI-2638HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QKI Products
Required fields are marked with *
My Review for All QKI Products
Required fields are marked with *
