Recombinant Human DGAT1 protein, His/SUMO-tagged
Cat.No. : | DGAT1-26H |
Product Overview : | Recombinant Human DGAT1(1-488 aa) fused with His/SUMO tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-488 aa |
Description : | This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN YEAPAAEA |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | DGAT1 diacylglycerol O-acyltransferase 1 [ Homo sapiens ] |
Official Symbol | DGAT1 |
Synonyms | DGAT1; diacylglycerol O-acyltransferase 1; diacylglycerol O acyltransferase homolog 1 (mouse); ARGP1; DGAT; ACAT related gene product 1; ACAT-related gene product 1; diglyceride acyltransferase; diacylglycerol O-acyltransferase homolog 1; acyl coenzyme A:cholesterol acyltransferase related gene 1; |
Gene ID | 8694 |
mRNA Refseq | NM_012079 |
Protein Refseq | NP_036211 |
MIM | 604900 |
UniProt ID | O75907 |
Chromosome Location | 8q24.3 |
Pathway | Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | 2-acylglycerol O-acyltransferase activity; O-acyltransferase activity; diacylglycerol O-acyltransferase activity; diacylglycerol binding; fatty acid binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
DGAT1-727H | Recombinant Human DGAT1 | +Inquiry |
RFL3982BF | Recombinant Full Length Bovine Diacylglycerol O-Acyltransferase 1(Dgat1) Protein, His-Tagged | +Inquiry |
DGAT1-2366H | Recombinant Human DGAT1 Transmembrane protein, His&Myc-tagged | +Inquiry |
Dgat1-728ML | Recombinant Mouse Dgat1 HEK293T cell lysate | +Inquiry |
RFL2319RF | Recombinant Full Length Rat Diacylglycerol O-Acyltransferase 1(Dgat1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGAT1 Products
Required fields are marked with *
My Review for All DGAT1 Products
Required fields are marked with *
0
Inquiry Basket