Recombinant Human DGAT1 protein, His/SUMO-tagged

Cat.No. : DGAT1-26H
Product Overview : Recombinant Human DGAT1(1-488 aa) fused with His/SUMO tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-488 aa
Description : This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases.
Form : Tris-based buffer,50% glycerol
AA Sequence : MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN YEAPAAEA
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name DGAT1 diacylglycerol O-acyltransferase 1 [ Homo sapiens ]
Official Symbol DGAT1
Synonyms DGAT1; diacylglycerol O-acyltransferase 1; diacylglycerol O acyltransferase homolog 1 (mouse); ARGP1; DGAT; ACAT related gene product 1; ACAT-related gene product 1; diglyceride acyltransferase; diacylglycerol O-acyltransferase homolog 1; acyl coenzyme A:cholesterol acyltransferase related gene 1;
Gene ID 8694
mRNA Refseq NM_012079
Protein Refseq NP_036211
MIM 604900
UniProt ID O75907
Chromosome Location 8q24.3
Pathway Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function 2-acylglycerol O-acyltransferase activity; O-acyltransferase activity; diacylglycerol O-acyltransferase activity; diacylglycerol binding; fatty acid binding; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGAT1 Products

Required fields are marked with *

My Review for All DGAT1 Products

Required fields are marked with *

0
cart-icon