Recombinant Human DGCR6L Protein, GST-tagged
| Cat.No. : | DGCR6L-2566H |
| Product Overview : | Human DGCR6L full-length ORF ( AAH00682.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DGCR6L DiGeorge syndrome critical region gene 6-like [ Homo sapiens ] |
| Official Symbol | DGCR6L |
| Synonyms | DGCR6L; DiGeorge syndrome critical region gene 6-like; protein DGCR6L; FLJ10666; DiGeorge syndrome critical region gene 6 like; diGeorge syndrome critical region 6-like protein; |
| Gene ID | 85359 |
| mRNA Refseq | NM_033257 |
| Protein Refseq | NP_150282 |
| MIM | 609459 |
| UniProt ID | Q9BY27 |
| ◆ Recombinant Proteins | ||
| DGCR6L-4872H | Recombinant Human DGCR6L protein, His-SUMO-tagged | +Inquiry |
| DGCR6L-570H | Recombinant Human DiGeorge syndrome critical region gene 6, His-tagged | +Inquiry |
| DGCR6L-2494HF | Recombinant Full Length Human DGCR6L Protein, GST-tagged | +Inquiry |
| DGCR6L-2566H | Recombinant Human DGCR6L Protein, GST-tagged | +Inquiry |
| DGCR6L-6260H | Recombinant Human DGCR6L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGCR6L-6963HCL | Recombinant Human DGCR6L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGCR6L Products
Required fields are marked with *
My Review for All DGCR6L Products
Required fields are marked with *
