Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DHRS1-4509H | 
| Product Overview : | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. | 
| Molecular Mass : | 33.9 kDa | 
| AA Sequence : | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | DHRS1 dehydrogenase/reductase 1 [ Homo sapiens (human) ] | 
| Official Symbol | DHRS1 | 
| Synonyms | DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523; | 
| Gene ID | 115817 | 
| mRNA Refseq | NM_138452 | 
| Protein Refseq | NP_612461 | 
| MIM | 610410 | 
| UniProt ID | Q96LJ7 | 
| ◆ Recombinant Proteins | ||
| DHRS1-5328H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| DHRS1-1079R | Recombinant Rhesus Macaque DHRS1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| DHRS1-11971H | Recombinant Human DHRS1, His-tagged | +Inquiry | 
| DHRS1-422Z | Recombinant Zebrafish DHRS1 | +Inquiry | 
| DHRS1-4509H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DHRS1 Products
Required fields are marked with *
My Review for All DHRS1 Products
Required fields are marked with *
  
        
    
      
            