Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DHRS1-4509H
Product Overview : DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 33.9 kDa
AA Sequence : MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DHRS1 dehydrogenase/reductase 1 [ Homo sapiens (human) ]
Official Symbol DHRS1
Synonyms DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523;
Gene ID 115817
mRNA Refseq NM_138452
Protein Refseq NP_612461
MIM 610410
UniProt ID Q96LJ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRS1 Products

Required fields are marked with *

My Review for All DHRS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon