Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DHRS1-5328H |
Product Overview : | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Mass : | 33.9 kDa |
AA Sequence : | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DHRS1 dehydrogenase/reductase 1 [ Homo sapiens (human) ] |
Official Symbol | DHRS1 |
Synonyms | DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523; |
Gene ID | 115817 |
mRNA Refseq | NM_001136050 |
Protein Refseq | NP_001129522 |
MIM | 610410 |
UniProt ID | Q96LJ7 |
◆ Recombinant Proteins | ||
DHRS1-422Z | Recombinant Zebrafish DHRS1 | +Inquiry |
DHRS1-2593H | Recombinant Human DHRS1 Protein, GST-tagged | +Inquiry |
Dhrs1-2548M | Recombinant Mouse Dhrs1 Protein, Myc/DDK-tagged | +Inquiry |
DHRS1-1079R | Recombinant Rhesus Macaque DHRS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS1-4509H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRS1 Products
Required fields are marked with *
My Review for All DHRS1 Products
Required fields are marked with *
0
Inquiry Basket