Recombinant Human DHRS4 protein, GST-tagged

• Cat.No.: DHRS4-11976H
• Product Overview: Recombinant Human DHRS4 protein(1-278 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-278 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: DHRS4 dehydrogenase/reductase (SDR family) member 4 [ Homo sapiens ]
• Official Symbol: DHRS4
• Synonyms: DHRS4; dehydrogenase/reductase (SDR family) member 4; dehydrogenase/reductase SDR family member 4; FLJ11008; humNRDR; SCAD SRL; SDR SRL; SDR25C2; short chain dehydrogenase/reductase family 25C; member 2; NADP-dependent retinol dehydrogenase; peroxisomal short-chain alcohol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; short-chain dehydrogenase/reductase family member 4; dehydrogenase/reductase (SDR family) member 4 like 2A; short chain dehydrogenase/reductase family 25C, member 1; short chain dehydrogenase/reductase family 25C, member 2; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; CR; NRDR; PHCR; PSCD; SDR-SRL; SDR25C1; SCAD-SRL
• Gene ID: 10901
• mRNA Refseq: NM_021004
• Protein Refseq: NP_066284
• MIM: 611596
• UniProt ID: Q9BTZ2