Recombinant Human DHRS4 protein, GST-tagged

Cat.No. : DHRS4-11976H
Product Overview : Recombinant Human DHRS4 protein(1-278 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability September 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-278 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name DHRS4 dehydrogenase/reductase (SDR family) member 4 [ Homo sapiens ]
Official Symbol DHRS4
Synonyms DHRS4; dehydrogenase/reductase (SDR family) member 4; dehydrogenase/reductase SDR family member 4; FLJ11008; humNRDR; SCAD SRL; SDR SRL; SDR25C2; short chain dehydrogenase/reductase family 25C; member 2; NADP-dependent retinol dehydrogenase; peroxisomal short-chain alcohol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; short-chain dehydrogenase/reductase family member 4; dehydrogenase/reductase (SDR family) member 4 like 2A; short chain dehydrogenase/reductase family 25C, member 1; short chain dehydrogenase/reductase family 25C, member 2; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; CR; NRDR; PHCR; PSCD; SDR-SRL; SDR25C1; SCAD-SRL;
Gene ID 10901
mRNA Refseq NM_021004
Protein Refseq NP_066284
MIM 611596
UniProt ID Q9BTZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRS4 Products

Required fields are marked with *

My Review for All DHRS4 Products

Required fields are marked with *

0
cart-icon
0
compare icon