Recombinant Human DHRS4 protein, GST-tagged
| Cat.No. : | DHRS4-11976H |
| Product Overview : | Recombinant Human DHRS4 protein(1-278 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-278 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DHRS4 dehydrogenase/reductase (SDR family) member 4 [ Homo sapiens ] |
| Official Symbol | DHRS4 |
| Synonyms | DHRS4; dehydrogenase/reductase (SDR family) member 4; dehydrogenase/reductase SDR family member 4; FLJ11008; humNRDR; SCAD SRL; SDR SRL; SDR25C2; short chain dehydrogenase/reductase family 25C; member 2; NADP-dependent retinol dehydrogenase; peroxisomal short-chain alcohol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; short-chain dehydrogenase/reductase family member 4; dehydrogenase/reductase (SDR family) member 4 like 2A; short chain dehydrogenase/reductase family 25C, member 1; short chain dehydrogenase/reductase family 25C, member 2; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; CR; NRDR; PHCR; PSCD; SDR-SRL; SDR25C1; SCAD-SRL; |
| Gene ID | 10901 |
| mRNA Refseq | NM_021004 |
| Protein Refseq | NP_066284 |
| MIM | 611596 |
| UniProt ID | Q9BTZ2 |
| ◆ Recombinant Proteins | ||
| DHRS4-2539HF | Recombinant Full Length Human DHRS4 Protein, GST-tagged | +Inquiry |
| DHRS4-26686TH | Recombinant Human DHRS4 Protein, His-tagged | +Inquiry |
| DHRS4-1326H | Recombinant Human Dehydrogenase/Reductase (SDR family) Member 4, His-tagged | +Inquiry |
| DHRS4-1861R | Recombinant Rat DHRS4 Protein | +Inquiry |
| DHRS4-11976H | Recombinant Human DHRS4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHRS4-6936HCL | Recombinant Human DHRS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS4 Products
Required fields are marked with *
My Review for All DHRS4 Products
Required fields are marked with *
