Recombinant Human DHRS4L2 Protein, GST-tagged
Cat.No. : | DHRS4L2-2600H |
Product Overview : | Human DHRS4L2 full-length ORF ( NP_932349.1, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the short chain dehydrogenase reductase family. The encoded protein may be an NADPH dependent retinol oxidoreductase. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010] |
Molecular Mass : | 51 kDa |
AA Sequence : | MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHRS4L2 dehydrogenase/reductase (SDR family) member 4 like 2 [ Homo sapiens ] |
Official Symbol | DHRS4L2 |
Synonyms | DHRS4L2; dehydrogenase/reductase (SDR family) member 4 like 2; dehydrogenase/reductase SDR family member 4-like 2; SDR25C3; short chain dehydrogenase/reductase family 25C; member 3; dehydrogenase/reductase (SDR family) member 4 like 2A3; short chain dehydrogenase/reductase family 25C, member 3; MGC905; FLJ11525; |
Gene ID | 317749 |
mRNA Refseq | NM_001193635 |
Protein Refseq | NP_001180564 |
MIM | 615196 |
UniProt ID | Q6PKH6 |
◆ Recombinant Proteins | ||
DHRS4L2-2540HF | Recombinant Full Length Human DHRS4L2 Protein, GST-tagged | +Inquiry |
DHRS4L2-2600H | Recombinant Human DHRS4L2 Protein, GST-tagged | +Inquiry |
DHRS4L2-371H | Recombinant Human DHRS4L2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS4L2-471HCL | Recombinant Human DHRS4L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS4L2 Products
Required fields are marked with *
My Review for All DHRS4L2 Products
Required fields are marked with *