Recombinant Human DHRSX protein, His-tagged
Cat.No. : | DHRSX-6743H |
Product Overview : | Recombinant Human DHRSX protein(1-330 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-330 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DHRSX dehydrogenase/reductase (SDR family) X-linked [ Homo sapiens ] |
Official Symbol | DHRSX |
Synonyms | DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11; |
Gene ID | 207063 |
mRNA Refseq | NM_145177 |
Protein Refseq | NP_660160 |
UniProt ID | Q8N5I4 |
◆ Recombinant Proteins | ||
DHRSX-11980H | Recombinant Human DHRSX protein, GST-tagged | +Inquiry |
DHRSX-6743H | Recombinant Human DHRSX protein, His-tagged | +Inquiry |
DHRSX-8191Z | Recombinant Zebrafish DHRSX | +Inquiry |
DHRSX-6317H | Recombinant Human DHRSX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dhrsx-2553M | Recombinant Mouse Dhrsx Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRSX-474HCL | Recombinant Human DHRSX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRSX Products
Required fields are marked with *
My Review for All DHRSX Products
Required fields are marked with *