Recombinant Human DHRSX protein, GST-tagged

Cat.No. : DHRSX-11980H
Product Overview : Recombinant Human DHRSX protein(1-330 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability December 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-330 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name DHRSX dehydrogenase/reductase (SDR family) X-linked [ Homo sapiens ]
Official Symbol DHRSX
Synonyms DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11;
Gene ID 207063
mRNA Refseq NM_145177
Protein Refseq NP_660160
UniProt ID Q8N5I4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRSX Products

Required fields are marked with *

My Review for All DHRSX Products

Required fields are marked with *

0
cart-icon
0
compare icon