Recombinant Human DHRSX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DHRSX-6317H |
Product Overview : | DHRSX MS Standard C13 and N15-labeled recombinant protein (NP_660160) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DHRSX (Dehydrogenase/Reductase X-Linked) is a Protein Coding gene. Diseases associated with DHRSX include Partington X-Linked Mental Retardation Syndrome. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH13. |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DHRSX dehydrogenase/reductase X-linked [ Homo sapiens (human) ] |
Official Symbol | DHRSX |
Synonyms | DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11; |
Gene ID | 207063 |
mRNA Refseq | NM_145177 |
Protein Refseq | NP_660160 |
MIM | 301034 |
UniProt ID | Q8N5I4 |
◆ Recombinant Proteins | ||
DHRSX-757H | Recombinant Human DHRSX Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRSX-6317H | Recombinant Human DHRSX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dhrsx-2553M | Recombinant Mouse Dhrsx Protein, Myc/DDK-tagged | +Inquiry |
DHRSX-2604H | Recombinant Human DHRSX Protein, GST-tagged | +Inquiry |
DHRSX-2549HF | Recombinant Full Length Human DHRSX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRSX-474HCL | Recombinant Human DHRSX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRSX Products
Required fields are marked with *
My Review for All DHRSX Products
Required fields are marked with *
0
Inquiry Basket