Recombinant Human DHTKD1 Protein, GST-tagged

• Cat.No.: DHTKD1-3031H
• Product Overview: Recombinant Human DHTKD1 Protein(32-197 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 32-197 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: DHTKD1 dehydrogenase E1 and transketolase domain containing 1 [ Homo sapiens ]
• Official Symbol: DHTKD1
• Synonyms: DHTKD1; dehydrogenase E1 and transketolase domain containing 1; probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial; dehydrogenase E1 and transketolase domain-containing protein 1; MGC3090; KIAA1630; DKFZp762M115
• Gene ID: 55526
• mRNA Refseq: NM_018706
• Protein Refseq: NP_061176