Recombinant Human DHTKD1 Protein, GST-tagged
| Cat.No. : | DHTKD1-3031H |
| Product Overview : | Recombinant Human DHTKD1 Protein(32-197 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 32-197 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | DHTKD1 dehydrogenase E1 and transketolase domain containing 1 [ Homo sapiens ] |
| Official Symbol | DHTKD1 |
| Synonyms | DHTKD1; dehydrogenase E1 and transketolase domain containing 1; probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial; dehydrogenase E1 and transketolase domain-containing protein 1; MGC3090; KIAA1630; DKFZp762M115; |
| Gene ID | 55526 |
| mRNA Refseq | NM_018706 |
| Protein Refseq | NP_061176 |
| ◆ Recombinant Proteins | ||
| DHTKD1-1909Z | Recombinant Zebrafish DHTKD1 | +Inquiry |
| DHTKD1-3030H | Recombinant Human DHTKD1 protein, His-tagged | +Inquiry |
| DHTKD1-4570M | Recombinant Mouse DHTKD1 Protein | +Inquiry |
| DHTKD1-2362M | Recombinant Mouse DHTKD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DHTKD1-3031H | Recombinant Human DHTKD1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHTKD1-475HCL | Recombinant Human DHTKD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHTKD1 Products
Required fields are marked with *
My Review for All DHTKD1 Products
Required fields are marked with *
