Recombinant Human DHX15 protein, His-tagged
Cat.No. : | DHX15-05H |
Product Overview : | Recombinant Human DHX15 protein(147-517 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 147-517 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | TDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DHX15 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [ Homo sapiens ] |
Official Symbol | DHX15 |
Synonyms | DHX15; DEAH (Asp-Glu-Ala-His) box polypeptide 15; DDX15, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 15; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15; DBP1; HRH2; PRP43; PRPF43; PrPp43p; DEAD/H box-15; RNA helicase 2; DEAH box protein 15; ATP-dependent RNA helicase #46; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15; DDX15; |
Gene ID | 1665 |
mRNA Refseq | NM_001358 |
Protein Refseq | NP_001349 |
MIM | 603403 |
UniProt ID | O43143 |
◆ Recombinant Proteins | ||
DHX15-5932H | Recombinant Human DHX15 Full Length protein | +Inquiry |
DHX15-2551HF | Recombinant Full Length Human DHX15 Protein, GST-tagged | +Inquiry |
DHX15-1086R | Recombinant Rhesus Macaque DHX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHX15-2606H | Recombinant Human DHX15 Protein, GST-tagged | +Inquiry |
DHX15-758H | Recombinant Human DHX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX15-6933HCL | Recombinant Human DHX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHX15 Products
Required fields are marked with *
My Review for All DHX15 Products
Required fields are marked with *