Recombinant Human DIABLO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DIABLO-4238H |
Product Overview : | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLREDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DIABLO diablo IAP-binding mitochondrial protein [ Homo sapiens (human) ] |
Official Symbol | DIABLO |
Synonyms | DIABLO; diablo, IAP-binding mitochondrial protein; diablo homolog, mitochondrial; DFNA64; DIABLO S; FLJ10537; FLJ25049; second mitochondria derived activator of caspase; SMAC; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase; SMAC3; DIABLO-S; |
Gene ID | 56616 |
mRNA Refseq | NM_138930 |
Protein Refseq | NP_620308 |
MIM | 605219 |
UniProt ID | Q9NR28 |
◆ Recombinant Proteins | ||
DIABLO-2617H | Recombinant Human DIABLO Protein | +Inquiry |
DIABLO-23H | Recombinant Human DIABLO protein, GST/His-tagged | +Inquiry |
DIABLO-0877H | Recombinant Human DIABLO Protein (A56-D239), Tag Free | +Inquiry |
DIABLO-30929TH | Recombinant Human DIABLO, His-tagged | +Inquiry |
Diablo-2563M | Recombinant Mouse Diablo Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIABLO-6927HCL | Recombinant Human DIABLO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIABLO Products
Required fields are marked with *
My Review for All DIABLO Products
Required fields are marked with *