Recombinant Human DIABLO Protein, GST-tagged
| Cat.No. : | DIABLO-106H |
| Product Overview : | Recombinant Human DIABLO Protien(NP_063940)(1-239 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-239 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | DIABLO diablo, IAP-binding mitochondrial protein [ Homo sapiens ] |
| Official Symbol | DIABLO |
| Synonyms | DIABLO; diablo, IAP-binding mitochondrial protein; diablo homolog, mitochondrial; DFNA64; DIABLO S; FLJ10537; FLJ25049; second mitochondria derived activator of caspase; SMAC; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase; SMAC3; DIABLO-S; |
| Gene ID | 56616 |
| mRNA Refseq | NM_019887 |
| Protein Refseq | NP_063940 |
| MIM | 605219 |
| UniProt ID | Q9NR28 |
| ◆ Recombinant Proteins | ||
| DIABLO-4238H | Recombinant Human DIABLO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DIABLO-4587M | Recombinant Mouse DIABLO Protein | +Inquiry |
| DIABLO-30928TH | Recombinant Human DIABLO, T7 -tagged | +Inquiry |
| DIABLO-0877H | Recombinant Human DIABLO Protein (A56-D239), Tag Free | +Inquiry |
| DIABLO-106H | Recombinant Human DIABLO Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIABLO-6927HCL | Recombinant Human DIABLO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIABLO Products
Required fields are marked with *
My Review for All DIABLO Products
Required fields are marked with *
