Recombinant Human DIAPH3 protein, His-tagged
Cat.No. : | DIAPH3-1483H |
Product Overview : | Recombinant Human DIAPH3(500 - 850 aa) fused with His tag at N-terminal was expressed in E. coli . |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 500 - 850 aa |
Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
Molecular Mass : | ~44 kDa |
AA Sequence : | DQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFS KLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASK VSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAI DVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVM DNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL |
Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | DIAPH3 diaphanous homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | DIAPH3 |
Synonyms | DIAPH3; diaphanous homolog 3 (Drosophila); auditory neuropathy, autosomal dominant 1 , AUNA1, diaphanous (Drosophila, homolog) 3; protein diaphanous homolog 3; AN; DRF3; FLJ34705; NSDAN; diaphanous-related formin 3; diaphanous-related formin-3; auditory neuropathy, autosomal dominant 1; DIA2; AUNA1; diap3; mDia2; DKFZp434C0931; DKFZp686A13178; |
Gene ID | 81624 |
mRNA Refseq | NM_001042517 |
Protein Refseq | NP_001035982 |
MIM | 614567 |
UniProt ID | Q9NSV4 |
Chromosome Location | 13q21.2 |
Pathway | CDC42 signaling events, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; |
Function | Rho GTPase binding; actin binding; binding; |
◆ Recombinant Proteins | ||
DIAPH3-11993H | Recombinant Human DIAPH3, GST-tagged | +Inquiry |
DIAPH3-1483H | Recombinant Human DIAPH3 protein, His-tagged | +Inquiry |
DIAPH3-2623H | Recombinant Human DIAPH3 Protein, GST-tagged | +Inquiry |
DIAPH3-2558HF | Recombinant Full Length Human DIAPH3 Protein, GST-tagged | +Inquiry |
DIAPH3-1049Z | Recombinant Zebrafish DIAPH3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIAPH3-6924HCL | Recombinant Human DIAPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIAPH3 Products
Required fields are marked with *
My Review for All DIAPH3 Products
Required fields are marked with *
0
Inquiry Basket