Recombinant Human DIRAS3, His-tagged
Cat.No. : | DIRAS3-27416TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-229 of Human ARHI with N terminal His tag, 31kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-229 a.a. |
Description : | This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers. |
Conjugation : | HIS |
Tissue specificity : | Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers. |
Form : | Lyophilised:Reconstitute with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRV VVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLL GCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSV TKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDD THREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHM LLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
Sequence Similarities : | Belongs to the small GTPase superfamily. Di-Ras family. |
Full Length : | Full L. |
Gene Name | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
Official Symbol | DIRAS3 |
Synonyms | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; |
Gene ID | 9077 |
mRNA Refseq | NM_004675 |
Protein Refseq | NP_004666 |
MIM | 605193 |
Uniprot ID | O95661 |
Chromosome Location | 1p31 |
Function | GTP binding; GTPase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
DIRAS3-2573HF | Recombinant Full Length Human DIRAS3 Protein, GST-tagged | +Inquiry |
DIRAS3-128H | Recombinant Human DIRAS3, Fc tagged | +Inquiry |
DIRAS3-292HFL | Active Recombinant Full Length Human DIRAS3 Protein, C-Flag-tagged | +Inquiry |
DIRAS3-6778H | Recombinant Human DIRAS3 protein, His-tagged | +Inquiry |
DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *