Recombinant Human DIS3L2 protein, GST-tagged
| Cat.No. : | DIS3L2-301158H |
| Product Overview : | Recombinant Human DIS3L2 (1-170 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ala1-Ser170 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 [ Homo sapiens ] |
| Official Symbol | DIS3L2 |
| Synonyms | DIS3L2; DIS3 mitotic control homolog (S. cerevisiae)-like 2; FAM6A, family with sequence similarity 6, member A; DIS3-like exonuclease 2; FLJ36974; MGC42174; family with sequence similarity 6, member A; FAM6A; PRLMNS; |
| Gene ID | 129563 |
| mRNA Refseq | NM_001257281 |
| Protein Refseq | NP_001244210 |
| MIM | 614184 |
| UniProt ID | Q8IYB7 |
| ◆ Recombinant Proteins | ||
| DIS3L2-2577HF | Recombinant Full Length Human DIS3L2 Protein, GST-tagged | +Inquiry |
| DIS3L2-1725HFL | Recombinant Full Length Human DIS3L2 Protein, C-Flag-tagged | +Inquiry |
| DIS3L2-2641H | Recombinant Human DIS3L2 Protein, GST-tagged | +Inquiry |
| DIS3L2-2385M | Recombinant Mouse DIS3L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIS3L2-765H | Recombinant Human DIS3L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIS3L2-1103HCL | Recombinant Human DIS3L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIS3L2 Products
Required fields are marked with *
My Review for All DIS3L2 Products
Required fields are marked with *




