Recombinant Human DIS3L2 protein, GST-tagged

Cat.No. : DIS3L2-301158H
Product Overview : Recombinant Human DIS3L2 (1-170 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ala1-Ser170
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 [ Homo sapiens ]
Official Symbol DIS3L2
Synonyms DIS3L2; DIS3 mitotic control homolog (S. cerevisiae)-like 2; FAM6A, family with sequence similarity 6, member A; DIS3-like exonuclease 2; FLJ36974; MGC42174; family with sequence similarity 6, member A; FAM6A; PRLMNS;
Gene ID 129563
mRNA Refseq NM_001257281
Protein Refseq NP_001244210
MIM 614184
UniProt ID Q8IYB7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIS3L2 Products

Required fields are marked with *

My Review for All DIS3L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon