Recombinant Human DIS3L2 protein, GST-tagged

• Cat.No.: DIS3L2-301158H
• Product Overview: Recombinant Human DIS3L2 (1-170 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ala1-Ser170
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 [ Homo sapiens ]
• Official Symbol: DIS3L2
• Synonyms: DIS3L2; DIS3 mitotic control homolog (S. cerevisiae)-like 2; FAM6A, family with sequence similarity 6, member A; DIS3-like exonuclease 2; FLJ36974; MGC42174; family with sequence similarity 6, member A; FAM6A; PRLMNS
• Gene ID: 129563
• mRNA Refseq: NM_001257281
• Protein Refseq: NP_001244210
• MIM: 614184
• UniProt ID: Q8IYB7