Recombinant Human DLK2 Protein (27-306 aa), GST-tagged
Cat.No. : | DLK2-1044H |
Product Overview : | Recombinant Human DLK2 Protein (27-306 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 27-306 aa |
Description : | Regulates adipogenesis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 56.8 kDa |
AA Sequence : | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | DLK2 delta-like 2 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | DLK2 |
Synonyms | DLK2; MGC2487; DLK-2; EGFL9; MGC111055; |
Gene ID | 65989 |
mRNA Refseq | NM_023932 |
Protein Refseq | NP_076421 |
UniProt ID | Q6UY11 |
◆ Recombinant Proteins | ||
DLK2-4630M | Recombinant Mouse DLK2 Protein | +Inquiry |
DLK2-26913TH | Recombinant Human DLK2, Fc-tagged | +Inquiry |
DLK2-1545R | Recombinant Rat DLK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLK2-1044H | Recombinant Human DLK2 Protein (27-306 aa), GST-tagged | +Inquiry |
DLK2-2684H | Recombinant Human DLK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK2-536HCL | Recombinant Human DLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLK2 Products
Required fields are marked with *
My Review for All DLK2 Products
Required fields are marked with *
0
Inquiry Basket