Recombinant Human DLK2 Protein (27-306 aa), GST-tagged

Cat.No. : DLK2-1044H
Product Overview : Recombinant Human DLK2 Protein (27-306 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 27-306 aa
Description : Regulates adipogenesis.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 56.8 kDa
AA Sequence : DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name DLK2 delta-like 2 homolog (Drosophila) [ Homo sapiens ]
Official Symbol DLK2
Synonyms DLK2; MGC2487; DLK-2; EGFL9; MGC111055;
Gene ID 65989
mRNA Refseq NM_023932
Protein Refseq NP_076421
UniProt ID Q6UY11

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLK2 Products

Required fields are marked with *

My Review for All DLK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon