Recombinant Human DLL1 Protein, GST-tagged

Cat.No. : DLL1-2686H
Product Overview : Human DLL1 partial ORF ( NP_005609, 18 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.86 kDa
AA Sequence : QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DLL1 delta-like 1 (Drosophila) [ Homo sapiens ]
Official Symbol DLL1
Synonyms DLL1; delta-like 1 (Drosophila); delta (Drosophila) like 1; delta-like protein 1; H-Delta-1; drosophila Delta homolog 1; DL1; Delta; DELTA1;
Gene ID 28514
mRNA Refseq NM_005618
Protein Refseq NP_005609
MIM 606582
UniProt ID O00548

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLL1 Products

Required fields are marked with *

My Review for All DLL1 Products

Required fields are marked with *

0
cart-icon