Recombinant Human DLL1 Protein, GST-tagged
Cat.No. : | DLL1-2686H |
Product Overview : | Human DLL1 partial ORF ( NP_005609, 18 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.86 kDa |
AA Sequence : | QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLL1 delta-like 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | DLL1 |
Synonyms | DLL1; delta-like 1 (Drosophila); delta (Drosophila) like 1; delta-like protein 1; H-Delta-1; drosophila Delta homolog 1; DL1; Delta; DELTA1; |
Gene ID | 28514 |
mRNA Refseq | NM_005618 |
Protein Refseq | NP_005609 |
MIM | 606582 |
UniProt ID | O00548 |
◆ Recombinant Proteins | ||
DLL1-4343H | Recombinant Human DLL1 protein, His-tagged | +Inquiry |
DLL1-200H | Recombinant Human DLL1 Protein, His-tagged | +Inquiry |
Dll1-2562M | Active Recombinant Mouse Dll1 protein, Fc-tagged | +Inquiry |
DLL1-1546R | Recombinant Rat DLL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLL1-802H | Recombinant Human DLL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLL1-2029MCL | Recombinant Mouse DLL1 cell lysate | +Inquiry |
DLL1-001RCL | Recombinant Rat DLL1 cell lysate | +Inquiry |
DLL1-2461HCL | Recombinant Human DLL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL1 Products
Required fields are marked with *
My Review for All DLL1 Products
Required fields are marked with *