Recombinant Human DLX5 protein, GST-tagged
| Cat.No. : | DLX5-28H |
| Product Overview : | Recombinant Human DLX5(1 a.a. - 289 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-289 a.a. |
| Description : | This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 57.53 kDa |
| AA Sequence : | MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQY QYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLA ALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWE PQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | DLX5 distal-less homeobox 5 [ Homo sapiens ] |
| Official Symbol | DLX5 |
| Synonyms | DLX5; distal-less homeobox 5; distal less homeo box 5; homeobox protein DLX-5; distal-less homeo box 5; split hand/foot malformation type 1 with sensorineural hearing loss; SHFM1D; |
| Gene ID | 1749 |
| mRNA Refseq | NM_005221 |
| Protein Refseq | NP_005212 |
| MIM | 600028 |
| UniProt ID | P56178 |
| Chromosome Location | 7q21.3 |
| Function | HMG box domain binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding; |
| ◆ Recombinant Proteins | ||
| DLX5-2926H | Recombinant Human Distal-less Homeobox 5, His-tagged | +Inquiry |
| DLX5-1889R | Recombinant Rat DLX5 Protein | +Inquiry |
| DLX5-301106H | Recombinant Human DLX5 protein, GST-tagged | +Inquiry |
| DLX5-5735C | Recombinant Chicken DLX5 | +Inquiry |
| DLX5-1548R | Recombinant Rat DLX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLX5-6903HCL | Recombinant Human DLX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLX5 Products
Required fields are marked with *
My Review for All DLX5 Products
Required fields are marked with *
