Recombinant Human DLX5 protein, GST-tagged
Cat.No. : | DLX5-301106H |
Product Overview : | Recombinant Human DLX5 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Tyr289 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DLX5 distal-less homeobox 5 [ Homo sapiens ] |
Official Symbol | DLX5 |
Synonyms | DLX5; distal-less homeobox 5; distal less homeo box 5; homeobox protein DLX-5; distal-less homeo box 5; split hand/foot malformation type 1 with sensorineural hearing loss; SHFM1D; |
Gene ID | 1749 |
mRNA Refseq | NM_005221 |
Protein Refseq | NP_005212 |
MIM | 600028 |
UniProt ID | P56178 |
◆ Recombinant Proteins | ||
DLX5-1548R | Recombinant Rat DLX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLX5-4638M | Recombinant Mouse DLX5 Protein | +Inquiry |
DLX5-301106H | Recombinant Human DLX5 protein, GST-tagged | +Inquiry |
DLX5-5735C | Recombinant Chicken DLX5 | +Inquiry |
DLX5-600HF | Recombinant Full Length Human DLX5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX5-6903HCL | Recombinant Human DLX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLX5 Products
Required fields are marked with *
My Review for All DLX5 Products
Required fields are marked with *
0
Inquiry Basket