Recombinant Human DNAI1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DNAI1-1339H |
Product Overview : | DNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_036276) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the dynein intermediate chain family. The encoded protein is part of the dynein complex in respiratory cilia. The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generating proteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the base of the dynein arm, help mediate attachment and may also participate in regulating dynein activity. Mutations in this gene result in abnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia and Kartagener syndrome. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 79.3 kDa |
AA Sequence : | MIPASAKSPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTCNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHQVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DNAI1 dynein axonemal intermediate chain 1 [ Homo sapiens (human) ] |
Official Symbol | DNAI1 |
Synonyms | DNAI1; dynein, axonemal, intermediate chain 1; dynein, axonemal, intermediate polypeptide 1; dynein intermediate chain 1, axonemal; CILD1; PCD; immotile cilia syndrome 1; dynein intermediate chain DNAI1; axonemal dynein intermediate chain 1; ICS; ICS1; MGC26204; |
Gene ID | 27019 |
mRNA Refseq | NM_012144 |
Protein Refseq | NP_036276 |
MIM | 604366 |
UniProt ID | Q9UI46 |
◆ Recombinant Proteins | ||
DNAI1-1898R | Recombinant Rat DNAI1 Protein | +Inquiry |
DNAI1-771H | Recombinant Human DNAI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dnai1-2591M | Recombinant Mouse Dnai1 Protein, Myc/DDK-tagged | +Inquiry |
DNAI1-4050HF | Recombinant Full Length Human DNAI1 Protein, GST-tagged | +Inquiry |
DNAI1-2186HFL | Recombinant Full Length Human DNAI1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAI1-6896HCL | Recombinant Human DNAI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAI1 Products
Required fields are marked with *
My Review for All DNAI1 Products
Required fields are marked with *
0
Inquiry Basket