Recombinant Human DNAJA2, His-tagged
Cat.No. : | DNAJA2-28365TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 49-412 of Human DNAJA2 with an N terminal His tag. Predicted mwt: 41 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 49-412 a.a. |
Description : | The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIF SHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLED LYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKK CEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPG VEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQY RNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSR PEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ |
Sequence Similarities : | Contains 1 CR-type zinc finger.Contains 1 J domain. |
Gene Name | DNAJA2 DnaJ (Hsp40) homolog, subfamily A, member 2 [ Homo sapiens ] |
Official Symbol | DNAJA2 |
Synonyms | DNAJA2; DnaJ (Hsp40) homolog, subfamily A, member 2; dnaJ homolog subfamily A member 2; CPR3; DNAJ; DNJ3; HIRIP4; |
Gene ID | 10294 |
mRNA Refseq | NM_005880 |
Protein Refseq | NP_005871 |
MIM | 611322 |
Uniprot ID | O60884 |
Chromosome Location | 16q12.1 |
Pathway | Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function | ATP binding; glycoprotein binding; heat shock protein binding; metal ion binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
DNAJA2-772H | Recombinant Human DNAJA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJA2-28365TH | Recombinant Human DNAJA2, His-tagged | +Inquiry |
DNAJA2-12055H | Recombinant Human DNAJA2, GST-tagged | +Inquiry |
DNAJA2-2726H | Recombinant Human DNAJA2 Protein, GST-tagged | +Inquiry |
DNAJA2-2432M | Recombinant Mouse DNAJA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJA2-6894HCL | Recombinant Human DNAJA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJA2 Products
Required fields are marked with *
My Review for All DNAJA2 Products
Required fields are marked with *