Recombinant Human DNAJA2, His-tagged

Cat.No. : DNAJA2-28365TH
Product Overview : Recombinant fragment, corresponding to amino acids 49-412 of Human DNAJA2 with an N terminal His tag. Predicted mwt: 41 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 49-412 a.a.
Description : The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIF SHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLED LYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKK CEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPG VEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQY RNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSR PEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
Sequence Similarities : Contains 1 CR-type zinc finger.Contains 1 J domain.
Gene Name DNAJA2 DnaJ (Hsp40) homolog, subfamily A, member 2 [ Homo sapiens ]
Official Symbol DNAJA2
Synonyms DNAJA2; DnaJ (Hsp40) homolog, subfamily A, member 2; dnaJ homolog subfamily A member 2; CPR3; DNAJ; DNJ3; HIRIP4;
Gene ID 10294
mRNA Refseq NM_005880
Protein Refseq NP_005871
MIM 611322
Uniprot ID O60884
Chromosome Location 16q12.1
Pathway Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;
Function ATP binding; glycoprotein binding; heat shock protein binding; metal ion binding; unfolded protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJA2 Products

Required fields are marked with *

My Review for All DNAJA2 Products

Required fields are marked with *

0
cart-icon