Recombinant Human DNAJA2, His-tagged

• Cat.No.: DNAJA2-28365TH
• Product Overview: Recombinant fragment, corresponding to amino acids 49-412 of Human DNAJA2 with an N terminal His tag. Predicted mwt: 41 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 49-412 a.a.
• Description: The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 89 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIF SHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLED LYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKK CEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPG VEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQY RNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSR PEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
• Sequence Similarities: Contains 1 CR-type zinc finger.Contains 1 J domain.

Gene Information

• Gene Name: DNAJA2 DnaJ (Hsp40) homolog, subfamily A, member 2 [ Homo sapiens ]
• Official Symbol: DNAJA2
• Synonyms: DNAJA2; DnaJ (Hsp40) homolog, subfamily A, member 2; dnaJ homolog subfamily A member 2; CPR3; DNAJ; DNJ3; HIRIP4
• Gene ID: 10294
• mRNA Refseq: NM_005880
• Protein Refseq: NP_005871
• MIM: 611322
• Uniprot ID: O60884
• Chromosome Location: 16q12.1
• Pathway: Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem
• Function: ATP binding; glycoprotein binding; heat shock protein binding; metal ion binding; unfolded protein binding