Recombinant Human DNASE1 protein(61-130 aa), C-His-tagged

Cat.No. : DNASE1-2702H
Product Overview : Recombinant Human DNASE1 protein(P24855)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 61-130 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EVRDSHLTAVGKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDT
Gene Name DNASE1 deoxyribonuclease I [ Homo sapiens ]
Official Symbol DNASE1
Synonyms DNASE1; deoxyribonuclease I; DNL1; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I; DRNI; FLJ38093; FLJ44902; DKFZp686H0155;
Gene ID 1773
mRNA Refseq NM_005223
Protein Refseq NP_005214
MIM 125505
UniProt ID P24855

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNASE1 Products

Required fields are marked with *

My Review for All DNASE1 Products

Required fields are marked with *

0
cart-icon