Recombinant Human DNASE1 protein(61-130 aa), C-His-tagged
Cat.No. : | DNASE1-2702H |
Product Overview : | Recombinant Human DNASE1 protein(P24855)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-130 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EVRDSHLTAVGKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDT |
Gene Name | DNASE1 deoxyribonuclease I [ Homo sapiens ] |
Official Symbol | DNASE1 |
Synonyms | DNASE1; deoxyribonuclease I; DNL1; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I; DRNI; FLJ38093; FLJ44902; DKFZp686H0155; |
Gene ID | 1773 |
mRNA Refseq | NM_005223 |
Protein Refseq | NP_005214 |
MIM | 125505 |
UniProt ID | P24855 |
◆ Recombinant Proteins | ||
DNASE1-4032HF | Recombinant Full Length Human DNASE1 Protein, GST-tagged | +Inquiry |
IL6ST-145C | Recombinant Cynomolgus DNASE1, His tagged | +Inquiry |
DNASE1-2810H | Recombinant Human DNASE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNASE1-207H | Recombinant Human DNASE1, His tagged | +Inquiry |
DNASE1-1227B | Recombinant Bovine Deoxyribonuclease I | +Inquiry |
◆ Native Proteins | ||
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1-866HCL | Recombinant Human DNASE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNASE1 Products
Required fields are marked with *
My Review for All DNASE1 Products
Required fields are marked with *
0
Inquiry Basket