Recombinant Human DNASE1 protein(61-130 aa), C-His-tagged
| Cat.No. : | DNASE1-2702H |
| Product Overview : | Recombinant Human DNASE1 protein(P24855)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 61-130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EVRDSHLTAVGKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDT |
| Gene Name | DNASE1 deoxyribonuclease I [ Homo sapiens ] |
| Official Symbol | DNASE1 |
| Synonyms | DNASE1; deoxyribonuclease I; DNL1; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I; DRNI; FLJ38093; FLJ44902; DKFZp686H0155; |
| Gene ID | 1773 |
| mRNA Refseq | NM_005223 |
| Protein Refseq | NP_005214 |
| MIM | 125505 |
| UniProt ID | P24855 |
| ◆ Recombinant Proteins | ||
| DNASE1-12094H | Recombinant Human DNASE1, GST-tagged | +Inquiry |
| DNASE1-775H | Recombinant Human DNASE1 Protein, GST-His-tagged | +Inquiry |
| DNASE1-2774H | Recombinant Human DNASE1 Protein, GST-tagged | +Inquiry |
| DNASE1-0029B | Recombinant Bovine DNASE1 Protein (Met1-Thr282), N-His-tagged | +Inquiry |
| DNASE1-3522H | Recombinant Human DNASE1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNASE1-866HCL | Recombinant Human DNASE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1 Products
Required fields are marked with *
My Review for All DNASE1 Products
Required fields are marked with *
