Recombinant Human DNM1L protein(501-570 aa), C-His-tagged
Cat.No. : | DNM1L-2457H |
Product Overview : | Recombinant Human DNM1L protein(O00429)(501-570 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 501-570 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNV |
Gene Name | DNM1L dynamin 1-like [ Homo sapiens ] |
Official Symbol | DNM1L |
Synonyms | DNM1L; dynamin 1-like; dynamin-1-like protein; DRP1; DVLP; DYMPLE; HDYNIV; VPS1; dynamin-like protein 4; dynamin-like protein IV; Dnm1p/Vps1p-like protein; dynamin-related protein 1; dynamin family member proline-rich carboxyl-terminal domain less; DLP1; EMPF; DYNIV-11; FLJ41912; |
Gene ID | 10059 |
mRNA Refseq | NM_005690 |
Protein Refseq | NP_005681 |
MIM | 603850 |
UniProt ID | O00429 |
◆ Recombinant Proteins | ||
DNM1L-1923R | Recombinant Rat DNM1L Protein | +Inquiry |
DNM1L-8494H | Recombinant Human DNM1L Protein, Myc/DDK-tagged | +Inquiry |
DNM1L-11163Z | Recombinant Zebrafish DNM1L | +Inquiry |
DNM1L-2584H | Recombinant Human DNM1L Protein (1-710 aa), His-Myc-tagged | +Inquiry |
DNM1L-2457H | Recombinant Human DNM1L protein(501-570 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNM1L-6859HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
DNM1L-6858HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNM1L Products
Required fields are marked with *
My Review for All DNM1L Products
Required fields are marked with *
0
Inquiry Basket