Recombinant Human DNM1L protein(501-570 aa), C-His-tagged

Cat.No. : DNM1L-2457H
Product Overview : Recombinant Human DNM1L protein(O00429)(501-570 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 501-570 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : FADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNV
Gene Name DNM1L dynamin 1-like [ Homo sapiens ]
Official Symbol DNM1L
Synonyms DNM1L; dynamin 1-like; dynamin-1-like protein; DRP1; DVLP; DYMPLE; HDYNIV; VPS1; dynamin-like protein 4; dynamin-like protein IV; Dnm1p/Vps1p-like protein; dynamin-related protein 1; dynamin family member proline-rich carboxyl-terminal domain less; DLP1; EMPF; DYNIV-11; FLJ41912;
Gene ID 10059
mRNA Refseq NM_005690
Protein Refseq NP_005681
MIM 603850
UniProt ID O00429

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNM1L Products

Required fields are marked with *

My Review for All DNM1L Products

Required fields are marked with *

0
cart-icon
0
compare icon