Recombinant Human DNMBP, His-tagged
Cat.No. : | DNMBP-28369TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1400-1577 of Human DNMBP with N terminal His tag; 178 amino acids, 44kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1400-1577 a.a. |
Description : | DNMBP belongs to the DBL (MIM 311030) family of guanine nucleotide exchange factors and plays a role in the regulation of cell junctions (Otani et al. |
Conjugation : | His |
Tissue specificity : | Detected in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPD STSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGY SVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGN QVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWW LAEVNGKKGYVPSNYIRKTEYT |
Sequence Similarities : | Contains 1 BAR domain.Contains 1 DH (DBL-homology) domain.Contains 6 SH3 domains. |
Gene Name | DNMBP dynamin binding protein [ Homo sapiens ] |
Official Symbol | DNMBP |
Synonyms | DNMBP; dynamin binding protein; dynamin-binding protein; ARHGEF36; KIAA1010; scaffold protein TUBA; Tuba; |
Gene ID | 23268 |
mRNA Refseq | NM_015221 |
Protein Refseq | NP_056036 |
MIM | 611282 |
Uniprot ID | Q6XZF7 |
Chromosome Location | 10q24.31 |
Pathway | Regulation of CDC42 activity, organism-specific biosystem; |
Function | Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding; |
◆ Recombinant Proteins | ||
DNMBP-28369TH | Recombinant Human DNMBP, His-tagged | +Inquiry |
DNMBP-2472M | Recombinant Mouse DNMBP Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMBP-2788H | Recombinant Human DNMBP Protein, GST-tagged | +Inquiry |
DNMBP-0394H | Recombinant Human DNMBP protein, His-tagged | +Inquiry |
DNMBP-4739M | Recombinant Mouse DNMBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMBP-501HCL | Recombinant Human DNMBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMBP Products
Required fields are marked with *
My Review for All DNMBP Products
Required fields are marked with *