Recombinant Human DNMT3A, His-tagged
Cat.No. : | DNMT3A-20H |
Product Overview : | Recombinant Human DNMT3A protein(NP_072046.2)(680-902aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 680-902aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.9kDa |
AA Sequence : | KIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ] |
Official Symbol | DNMT3A |
Synonyms | DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; DNA MTase HsaIIIA; DNA cytosine methyltransferase 3A2; DNMT3A2; M.HsaIIIA; |
Gene ID | 1788 |
mRNA Refseq | NM_022552.4 |
Protein Refseq | NP_072046.2 |
MIM | 602769 |
UniProt ID | Q9Y6K1 |
◆ Recombinant Proteins | ||
DNMT3A-2473M | Recombinant Mouse DNMT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMT3A-01H | Recombinant Human DNMT3A Protein, GST/StrepII-tagged | +Inquiry |
DNMT3A-1926R | Recombinant Rat DNMT3A Protein | +Inquiry |
DNMT3A-73H | Recombinant Human DNM3A protein, GST-tagged | +Inquiry |
DNMT3A-4741M | Recombinant Mouse DNMT3A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3A-6855HCL | Recombinant Human DNMT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNMT3A Products
Required fields are marked with *
My Review for All DNMT3A Products
Required fields are marked with *
0
Inquiry Basket