Recombinant Human DOCK5 Protein, GST-tagged

Cat.No. : DOCK5-2807H
Product Overview : Human DOCK5 partial ORF ( NP_079216, 771 a.a. - 865 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the dedicator of cytokinesis protein family. Members of this family act as guanine nucleotide exchange factors for small Rho family G proteins. The protein encoded by this gene is thought to associate with adaptors CRK and CRKL, and function in regulation of intestinal epithelial cell spreading and migration on collagen IV. Similar proteins in mouse and zebrafish also function in myoblast fusion. [provided by RefSeq, Oct 2016]
Molecular Mass : 36.19 kDa
AA Sequence : RVLYLRFYGQSKDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPDNQLVRQKLNCMTKIVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DOCK5 dedicator of cytokinesis 5 [ Homo sapiens ]
Official Symbol DOCK5
Synonyms DOCK5; dedicator of cytokinesis 5; dedicator of cytokinesis protein 5; FLJ21034; DKFZp451J181; DKFZp779M164; DKFZp781J211;
Gene ID 80005
mRNA Refseq NM_024940
Protein Refseq NP_079216
MIM 616904
UniProt ID Q9H7D0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOCK5 Products

Required fields are marked with *

My Review for All DOCK5 Products

Required fields are marked with *

0
cart-icon
0
compare icon