Recombinant Human DOCK5 Protein, GST-tagged
| Cat.No. : | DOCK5-2807H |
| Product Overview : | Human DOCK5 partial ORF ( NP_079216, 771 a.a. - 865 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the dedicator of cytokinesis protein family. Members of this family act as guanine nucleotide exchange factors for small Rho family G proteins. The protein encoded by this gene is thought to associate with adaptors CRK and CRKL, and function in regulation of intestinal epithelial cell spreading and migration on collagen IV. Similar proteins in mouse and zebrafish also function in myoblast fusion. [provided by RefSeq, Oct 2016] |
| Molecular Mass : | 36.19 kDa |
| AA Sequence : | RVLYLRFYGQSKDGDEFNNSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPDNQLVRQKLNCMTKIVE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DOCK5 dedicator of cytokinesis 5 [ Homo sapiens ] |
| Official Symbol | DOCK5 |
| Synonyms | DOCK5; dedicator of cytokinesis 5; dedicator of cytokinesis protein 5; FLJ21034; DKFZp451J181; DKFZp779M164; DKFZp781J211; |
| Gene ID | 80005 |
| mRNA Refseq | NM_024940 |
| Protein Refseq | NP_079216 |
| MIM | 616904 |
| UniProt ID | Q9H7D0 |
| ◆ Recombinant Proteins | ||
| Dock5-1368M | Recombinant Mouse Dock5 Protein, His-tagged | +Inquiry |
| DOCK5-2480M | Recombinant Mouse DOCK5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DOCK5-6086Z | Recombinant Zebrafish DOCK5 | +Inquiry |
| DOCK5-2807H | Recombinant Human DOCK5 Protein, GST-tagged | +Inquiry |
| DOCK5-1367H | Recombinant Human DOCK5 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOCK5 Products
Required fields are marked with *
My Review for All DOCK5 Products
Required fields are marked with *
