Recombinant Human DPH3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DPH3-1992H |
Product Overview : | DPH3 MS Standard C13 and N15-labeled recombinant protein (NP_996662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. |
Molecular Mass : | 9.2 kDa |
AA Sequence : | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DPH3 diphthamide biosynthesis 3 [ Homo sapiens (human) ] |
Official Symbol | DPH3 |
Synonyms | DESR1; DPH3A; KTI11; ZCSL2; DELGIP; DELGIP1 |
Gene ID | 285381 |
mRNA Refseq | NM_206831 |
Protein Refseq | NP_996662 |
MIM | 608959 |
UniProt ID | Q96FX2 |
◆ Recombinant Proteins | ||
DPH3-4076HF | Recombinant Full Length Human DPH3 Protein, GST-tagged | +Inquiry |
DPH3-2834H | Recombinant Human DPH3 Protein, GST-tagged | +Inquiry |
DPH3-7431Z | Recombinant Zebrafish DPH3 | +Inquiry |
DPH3-5600C | Recombinant Chicken DPH3 | +Inquiry |
Dph3-280M | Recombinant Mouse Dph3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPH3 Products
Required fields are marked with *
My Review for All DPH3 Products
Required fields are marked with *