Recombinant Human DPH3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DPH3-1992H | 
| Product Overview : | DPH3 MS Standard C13 and N15-labeled recombinant protein (NP_996662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a CSL zinc finger-containing protein that is required for dipthamide biosynthesis. The encoded protein is necessary for the initial step in the modification of a histidine residue in elongation factor-2 to diphthamide. This modified residue is a target for ADP ribosylation by the bacterial toxins diphtheria toxin and Pseudomonas exotoxin A. Alternative splicing results in multiple transcript variants that encode the same isoform. | 
| Molecular Mass : | 9.2 kDa | 
| AA Sequence : | MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKCTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | DPH3 diphthamide biosynthesis 3 [ Homo sapiens (human) ] | 
| Official Symbol | DPH3 | 
| Synonyms | DESR1; DPH3A; KTI11; ZCSL2; DELGIP; DELGIP1 | 
| Gene ID | 285381 | 
| mRNA Refseq | NM_206831 | 
| Protein Refseq | NP_996662 | 
| MIM | 608959 | 
| UniProt ID | Q96FX2 | 
| ◆ Recombinant Proteins | ||
| DPH3-5600C | Recombinant Chicken DPH3 | +Inquiry | 
| DPH3-2834H | Recombinant Human DPH3 Protein, GST-tagged | +Inquiry | 
| Dph3-280M | Recombinant Mouse Dph3 Protein, MYC/DDK-tagged | +Inquiry | 
| DPH3-4076HF | Recombinant Full Length Human DPH3 Protein, GST-tagged | +Inquiry | 
| DPH3-1992H | Recombinant Human DPH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DPH3-6836HCL | Recombinant Human DPH3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DPH3 Products
Required fields are marked with *
My Review for All DPH3 Products
Required fields are marked with *
  
        
    
      
            