Recombinant Human DPM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DPM2-1501H |
Product Overview : | DPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1. |
Molecular Mass : | 9.3 kDa |
AA Sequence : | MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKSKRVTKKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DPM2 dolichyl-phosphate mannosyltransferase subunit 2, regulatory [ Homo sapiens (human) ] |
Official Symbol | DPM2 |
Synonyms | DPM2; dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit; dolichol phosphate-mannose biosynthesis regulatory protein; MGC21559; MGC111193; dolichol phosphate-mannose synthase 2; FLJ80013; |
Gene ID | 8818 |
mRNA Refseq | NM_003863 |
Protein Refseq | NP_003854 |
MIM | 603564 |
UniProt ID | O94777 |
◆ Recombinant Proteins | ||
DPM2-1940R | Recombinant Rat DPM2 Protein | +Inquiry |
DPM2-1321R | Recombinant Rhesus monkey DPM2 Protein, His-tagged | +Inquiry |
DPM2-4241C | Recombinant Chicken DPM2 | +Inquiry |
DPM2-1501H | Recombinant Human DPM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dpm2-2638M | Recombinant Mouse Dpm2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPM2-6834HCL | Recombinant Human DPM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPM2 Products
Required fields are marked with *
My Review for All DPM2 Products
Required fields are marked with *