Recombinant Human DPM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DPM2-1501H
Product Overview : DPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1.
Molecular Mass : 9.3 kDa
AA Sequence : MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKSKRVTKKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DPM2 dolichyl-phosphate mannosyltransferase subunit 2, regulatory [ Homo sapiens (human) ]
Official Symbol DPM2
Synonyms DPM2; dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit; dolichol phosphate-mannose biosynthesis regulatory protein; MGC21559; MGC111193; dolichol phosphate-mannose synthase 2; FLJ80013;
Gene ID 8818
mRNA Refseq NM_003863
Protein Refseq NP_003854
MIM 603564
UniProt ID O94777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPM2 Products

Required fields are marked with *

My Review for All DPM2 Products

Required fields are marked with *

0
cart-icon