Recombinant Human DPP9 Protein, GST-tagged
Cat.No. : | DPP9-2851H |
Product Overview : | Human DPP9 partial ORF ( NP_631898.2, 24 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.3 kDa |
AA Sequence : | FQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPP9 dipeptidyl-peptidase 9 [ Homo sapiens ] |
Official Symbol | DPP9 |
Synonyms | DPP9; dipeptidyl-peptidase 9; dipeptidylpeptidase 9; dipeptidyl peptidase 9; DPP IX; dipeptidyl peptidase IX; dipeptidyl peptidase-like protein 9; dipeptidyl peptidase IV-related protein 2; dipeptidyl peptidase IV-related protein-2; DP9; DPLP9; DPRP2; DPRP-2; FLJ16073; DKFZp762F117; |
Gene ID | 91039 |
mRNA Refseq | NM_139159 |
Protein Refseq | NP_631898 |
MIM | 608258 |
UniProt ID | Q86TI2 |
◆ Recombinant Proteins | ||
DPP9-2508M | Recombinant Mouse DPP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPP9-12150H | Recombinant Human DPP9, GST-tagged | +Inquiry |
Dpp9-2645M | Recombinant Mouse Dpp9 Protein, Myc/DDK-tagged | +Inquiry |
DPP9-2427H | Recombinant Human DPP9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPP9-4676Z | Recombinant Zebrafish DPP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP9-6828HCL | Recombinant Human DPP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPP9 Products
Required fields are marked with *
My Review for All DPP9 Products
Required fields are marked with *