Recombinant Human DPP9 protein, His-tagged

Cat.No. : DPP9-675H
Product Overview : Recombinant Human DPP9 protein(Q86TI2)(585-788aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 585-788a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.7 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVAL
Gene Name DPP9 dipeptidyl-peptidase 9 [ Homo sapiens ]
Official Symbol DPP9
Synonyms DPP9; dipeptidyl-peptidase 9; dipeptidylpeptidase 9; dipeptidyl peptidase 9; DPP IX; dipeptidyl peptidase IX; dipeptidyl peptidase-like protein 9; dipeptidyl peptidase IV-related protein 2; dipeptidyl peptidase IV-related protein-2; DP9; DPLP9; DPRP2; DPRP-2; FLJ16073; DKFZp762F117;
Gene ID 91039
mRNA Refseq NM_139159
Protein Refseq NP_631898
MIM 608258
UniProt ID Q86TI2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPP9 Products

Required fields are marked with *

My Review for All DPP9 Products

Required fields are marked with *

0
cart-icon
0
compare icon