Recombinant Human DPT Protein, GST-tagged
| Cat.No. : | DPT-2855H |
| Product Overview : | Human DPT full-length ORF ( NP_001928.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 50.4 kDa |
| AA Sequence : | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPT dermatopontin [ Homo sapiens ] |
| Official Symbol | DPT |
| Synonyms | DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP; |
| Gene ID | 1805 |
| mRNA Refseq | NM_001937 |
| Protein Refseq | NP_001928 |
| MIM | 125597 |
| UniProt ID | Q07507 |
| ◆ Recombinant Proteins | ||
| DPT-322H | Active Recombinant Human DPT, His-tagged | +Inquiry |
| DPT-199H | Recombinant Human DPT protein, Fc-His-tagged | +Inquiry |
| Dpt-2647M | Recombinant Mouse Dpt Protein, Myc/DDK-tagged | +Inquiry |
| Dpt-674M | Recombinant Mouse Dpt Protein, His/GST-tagged | +Inquiry |
| DPT-673H | Recombinant Human DPT Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *
