Recombinant Human DPT Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DPT-4784H
Product Overview : DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin.
Molecular Mass : 24 kDa
AA Sequence : MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DPT dermatopontin [ Homo sapiens (human) ]
Official Symbol DPT
Synonyms DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP;
Gene ID 1805
mRNA Refseq NM_001937
Protein Refseq NP_001928
MIM 125597
UniProt ID Q07507

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPT Products

Required fields are marked with *

My Review for All DPT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon