Recombinant Human DPT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DPT-4784H
• Product Overview: DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin.
• Molecular Mass: 24 kDa
• AA Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DPT dermatopontin [ Homo sapiens (human) ]
• Official Symbol: DPT
• Synonyms: DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP
• Gene ID: 1805
• mRNA Refseq: NM_001937
• Protein Refseq: NP_001928
• MIM: 125597
• UniProt ID: Q07507