Recombinant Human DRD5

Cat.No. : DRD5-12H
Product Overview : Recombinant Human DRD5, fused without tag, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Form : Liquid
Molecular Mass : 52.47 kDa
AA Sequence : MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANM TNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKR KMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTY AISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGC SHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPV AESVWELDCEGEISLDKITPFTPNGFH
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
Official Symbol DRD5
Synonyms DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
Gene ID 1816
mRNA Refseq NM_000798
Protein Refseq NP_000789
MIM 126453
UniProt ID P21918
Chromosome Location 4p16.1
Pathway Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
Function G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRD5 Products

Required fields are marked with *

My Review for All DRD5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon