Recombinant Human DRD5
Cat.No. : | DRD5-12H |
Product Overview : | Recombinant Human DRD5, fused without tag, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. |
Form : | Liquid |
Molecular Mass : | 52.47 kDa |
AA Sequence : | MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANM TNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKR KMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTY AISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGC SHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPV AESVWELDCEGEISLDKITPFTPNGFH |
Applications : | Antibody Production; Functional Study; Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | DRD5 dopamine receptor D5 [ Homo sapiens (human) ] |
Official Symbol | DRD5 |
Synonyms | DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B |
Gene ID | 1816 |
mRNA Refseq | NM_000798 |
Protein Refseq | NP_000789 |
MIM | 126453 |
UniProt ID | P21918 |
Chromosome Location | 4p16.1 |
Pathway | Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD) |
Function | G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity |
◆ Recombinant Proteins | ||
DRD5-1992H | Recombinant Human DRD5 Protein (Asn351-His477), His tagged | +Inquiry |
RFL20193RF | Recombinant Full Length Rat D(1B) Dopamine Receptor(Drd5) Protein, His-Tagged | +Inquiry |
DRD5-12165H | Recombinant Human DRD5, His-tagged | +Inquiry |
DRD5-1959R | Recombinant Rat DRD5 Protein | +Inquiry |
DRD5-1383H | Recombinant Human DRD5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD5-6816HCL | Recombinant Human DRD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRD5 Products
Required fields are marked with *
My Review for All DRD5 Products
Required fields are marked with *
0
Inquiry Basket