Recombinant Human DRD5, GST-tagged
Cat.No. : | DRD5-13H |
Product Overview : | Recombinant Human DRD5, fused with N-terminal GST, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
Bio-activity : | Not tested. |
AA Sequence : | NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH(C-127aa encoded by BC009748) |
Storage : | Aliquot and store at -20ºC to -80ºC for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20ºC to -80ºC. |
Gene Name | DRD5 dopamine receptor D5 [ Homo sapiens (human) ] |
Official Symbol | DRD5 |
Synonyms | DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B |
Gene ID | 1816 |
mRNA Refseq | NM_000798 |
Protein Refseq | NP_000789 |
MIM | 126453 |
UniProt ID | P21918 |
Chromosome Location | 4p16.1 |
Pathway | Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD) |
Function | G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity |
◆ Recombinant Proteins | ||
DRD5-13H | Recombinant Human DRD5, GST-tagged | +Inquiry |
DRD5-1383H | Recombinant Human DRD5 Protein, His-tagged | +Inquiry |
DRD5-1992H | Recombinant Human DRD5 Protein (Asn351-His477), His tagged | +Inquiry |
DRD5-1959R | Recombinant Rat DRD5 Protein | +Inquiry |
DRD5-12165H | Recombinant Human DRD5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD5-6816HCL | Recombinant Human DRD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRD5 Products
Required fields are marked with *
My Review for All DRD5 Products
Required fields are marked with *