Recombinant Human DSC1 protein, His-tagged
Cat.No. : | DSC1-6424H |
Product Overview : | Recombinant Human DSC1 protein(607-689 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 607-689 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTRDVRPNVIL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DSC1 desmocollin 1 [ Homo sapiens ] |
Official Symbol | DSC1 |
Synonyms | DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3; |
Gene ID | 1823 |
mRNA Refseq | NM_004948 |
Protein Refseq | NP_004939 |
MIM | 125643 |
UniProt ID | Q08554 |
◆ Recombinant Proteins | ||
Dsc1-477M | Recombinant Mouse Dsc1 Protein, His-tagged | +Inquiry |
DSC1-3706H | Recombinant Human DSC1 protein, GST-tagged | +Inquiry |
DSC1-6424H | Recombinant Human DSC1 protein, His-tagged | +Inquiry |
DSC1-1384H | Recombinant Human DSC1 Protein, His&GST-tagged | +Inquiry |
RFL20506MF | Recombinant Full Length Mouse Desmocollin-1(Dsc1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC1 Products
Required fields are marked with *
My Review for All DSC1 Products
Required fields are marked with *