Recombinant Human DSCR4 Protein, GST-tagged
| Cat.No. : | DSCR4-2885H |
| Product Overview : | Human DSCR4 full-length ORF ( ADR82732.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. [provided by RefSeq, Jan 2015] |
| Molecular Mass : | 13 kDa |
| AA Sequence : | MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DSCR4 Down syndrome critical region gene 4 [ Homo sapiens ] |
| Official Symbol | DSCR4 |
| Synonyms | DSCR4; Down syndrome critical region gene 4; DCRB; DSCRB |
| Gene ID | 10281 |
| mRNA Refseq | NM_005867 |
| Protein Refseq | NP_005858 |
| MIM | 604829 |
| UniProt ID | P56555 |
| ◆ Recombinant Proteins | ||
| DSCR4-4633H | Recombinant Human DSCR4 protein, His-tagged | +Inquiry |
| DSCR4-2885H | Recombinant Human DSCR4 Protein, GST-tagged | +Inquiry |
| DSCR4-1902H | Recombinant Human DSCR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DSCR4-4199HF | Recombinant Full Length Human DSCR4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DSCR4-6809HCL | Recombinant Human DSCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSCR4 Products
Required fields are marked with *
My Review for All DSCR4 Products
Required fields are marked with *
