Recombinant Human DSCR4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DSCR4-1902H |
| Product Overview : | DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. |
| Molecular Mass : | 13 kDa |
| AA Sequence : | MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DSCR4 Down syndrome critical region gene 4 [ Homo sapiens (human) ] |
| Official Symbol | DSCR4 |
| Synonyms | DSCR4; Down syndrome critical region 4; DCRB; DSCRB; Down syndrome critical region gene 4; Down syndrome critical region protein 4; Down syndrome critical region protein B; AP001415.1 |
| Gene ID | 10281 |
| mRNA Refseq | NM_005867 |
| Protein Refseq | NP_005858 |
| MIM | 604829 |
| UniProt ID | P56555 |
| ◆ Recombinant Proteins | ||
| DSCR4-4199HF | Recombinant Full Length Human DSCR4 Protein, GST-tagged | +Inquiry |
| DSCR4-1902H | Recombinant Human DSCR4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DSCR4-4633H | Recombinant Human DSCR4 protein, His-tagged | +Inquiry |
| DSCR4-2885H | Recombinant Human DSCR4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DSCR4-6809HCL | Recombinant Human DSCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSCR4 Products
Required fields are marked with *
My Review for All DSCR4 Products
Required fields are marked with *
