Recombinant Human DUB3 Protein, GST-tagged
Cat.No. : | DUB3-2913H |
Product Overview : | Human DUB3 partial ORF ( NP_958804, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DUB3 is a member of the ubiquitin processing protease (UBP) subfamily of deubiquitinating enzymes. See USP1 (MIM 603478) for background information.[supplied by OMIM, Mar 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | ESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHPEQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | USP17L2 ubiquitin specific peptidase 17-like family member 2 [ Homo sapiens (human) ] |
Official Symbol | DUB3 |
Synonyms | USP17L2; ubiquitin specific peptidase 17-like family member 2; Ubiquitin Specific Peptidase 17-Like Family Member 2; Ubiquitin-Specific-Processing Protease 17-Like Protein 2; Ubiquitin Carboxyl-Terminal Hydrolase 17-Like Protein 2; Deubiquitinating Enzyme 17-Like Protein 2; Ubiquitin Thioesterase 17-Like Protein 2; Ubiquitin Specific Peptidase 17-Like 2; Deubiquitinating Protein 3; Deubiquitinating Enzyme 3; DUB-3; USP17; DUB3; Ubiquitin Thiolesterase 17-Like Protein 2; Ubiquitin Carboxyl-Terminal Hydrolase 17; EC 3.4.19.12; EC 3.1.2.15; USP17L; USP17H; USP17I; USP17J; USP17K; USP17M; ubiquitin carboxyl-terminal hydrolase 17; deubiquitinating enzyme 17-like protein 2; deubiquitinating enzyme 3; deubiquitinating protein 3; ubiquitin carboxyl-terminal hydrolase 17-like protein 2; ubiquitin specific peptidase 17-like 2; ubiquitin thioesterase 17-like protein 2; ubiquitin thiolesterase 17-like protein 2; ubiquitin-specific-processing protease 17-like protein 2; EC 3.4.19.12 |
Gene ID | 377630 |
mRNA Refseq | NM_201402 |
Protein Refseq | NP_958804 |
MIM | 610186 |
UniProt ID | Q6R6M4 |
◆ Recombinant Proteins | ||
DUB3-4081HF | Recombinant Full Length Human DUB3 Protein, GST-tagged | +Inquiry |
DUB3-3493H | Recombinant Human DUB3 protein, His-tagged | +Inquiry |
DUB3-2913H | Recombinant Human DUB3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUB3 Products
Required fields are marked with *
My Review for All DUB3 Products
Required fields are marked with *
0
Inquiry Basket