Recombinant Human DUS3L Protein, GST-tagged

Cat.No. : DUS3L-2919H
Product Overview : Human DUS3L full-length ORF ( NP_064560.1, 1 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DUS3L (Dihydrouridine Synthase 3 Like) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and tRNA dihydrouridine synthase activity. An important paralog of this gene is ENSG00000267157.
Molecular Mass : 98.9 kDa
AA Sequence : MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUS3L dihydrouridine synthase 3-like (S. cerevisiae) [ Homo sapiens ]
Official Symbol DUS3L
Synonyms DUS3L; dihydrouridine synthase 3-like (S. cerevisiae); tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like; DUS3; FLJ13896;
Gene ID 56931
mRNA Refseq NM_001161619
Protein Refseq NP_001155091
UniProt ID Q96G46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUS3L Products

Required fields are marked with *

My Review for All DUS3L Products

Required fields are marked with *

0
cart-icon