Recombinant Human DUS3L Protein, GST-tagged
Cat.No. : | DUS3L-2919H |
Product Overview : | Human DUS3L full-length ORF ( NP_064560.1, 1 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DUS3L (Dihydrouridine Synthase 3 Like) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and tRNA dihydrouridine synthase activity. An important paralog of this gene is ENSG00000267157. |
Molecular Mass : | 98.9 kDa |
AA Sequence : | MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUS3L dihydrouridine synthase 3-like (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DUS3L |
Synonyms | DUS3L; dihydrouridine synthase 3-like (S. cerevisiae); tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like; DUS3; FLJ13896; |
Gene ID | 56931 |
mRNA Refseq | NM_001161619 |
Protein Refseq | NP_001155091 |
UniProt ID | Q96G46 |
◆ Recombinant Proteins | ||
DUS3L-2559M | Recombinant Mouse DUS3L Protein, His (Fc)-Avi-tagged | +Inquiry |
DUS3L-4087HF | Recombinant Full Length Human DUS3L Protein, GST-tagged | +Inquiry |
DUS3L-2712H | Recombinant Human DUS3L Protein, MYC/DDK-tagged | +Inquiry |
DUS3L-1971R | Recombinant Rat DUS3L Protein | +Inquiry |
DUS3L-4872M | Recombinant Mouse DUS3L Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUS3L-514HCL | Recombinant Human DUS3L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUS3L Products
Required fields are marked with *
My Review for All DUS3L Products
Required fields are marked with *